PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00108.1_g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 313aa    MW: 35754.9 Da    PI: 5.1156
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00108.1_g00070.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-141461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_00108.1_g00070.1 14 KGPWTVEEDKKLINFILTNGHCCWRALPKLSGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding51.81.8e-1671111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_00108.1_g00070.1  71 SEYEEQMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                              777***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-19562IPR009057Homeodomain-like
PROSITE profilePS5129412.534961IPR017930Myb domain
SuperFamilySSF466897.86E-2711108IPR009057Homeodomain-like
SMARTSM007174.2E-111363IPR001005SANT/Myb domain
PfamPF002491.5E-121461IPR001005SANT/Myb domain
CDDcd001675.55E-81661No hitNo description
PROSITE profilePS5129426.27262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2463117IPR009057Homeodomain-like
SMARTSM007172.3E-1466114IPR001005SANT/Myb domain
PfamPF002495.8E-1471111IPR001005SANT/Myb domain
CDDcd001677.52E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTVE EDKKLINFIL TNGHCCWRAL PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGFL SEYEEQMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPMTHKPLL EGSQQQAHDE KNTNQEDQQT KKEEEQQYQL GKDLEKNNTP ISTDDGFCID  180
EVPLLNPHEI FVDISSAHHH TSDDNANFNI SNSTSPSSST SSCISSVPSD EFSKFLDEIE  240
IVDIKWLSSD DSSRDNINYN DAKFNDNVDT MNLWDINDLS SLELFMNDHD DSLVGSGCSR  300
MVINQDSLTF DIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759901e-174AF175990.1 Arabidopsis thaliana putative transcription factor (MYB43) mRNA, complete cds.
GenBankAY5196251e-174AY519625.1 Arabidopsis thaliana MYB transcription factor (At5g16600) mRNA, complete cds.
GenBankBT0027621e-174BT002762.1 Arabidopsis thaliana clone C105246 unknown protein (At5g16600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618404.10.0PREDICTED: myb-related protein 308-like
SwissprotQ50EX62e-82ODO1_PETHY; Protein ODORANT1
TrEMBLA0A078HI290.0A0A078HI29_BRANA; BnaC02g06730D protein
STRINGscaffold_601700.11e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-146myb domain protein 43